PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_28918-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 422aa    MW: 46024.3 Da    PI: 6.4599
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_28918-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.95.4e-1493135346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       WT eEd ll   v+++G g+W  +a++++  R++kqc++rw +
  TRIUR3_28918-P1  93 FWTVEEDTLLRAKVQEFGEGSWMQVASYLP-SRSGKQCRERWVN 135
                      6*****************************.***********88 PP

2Myb_DNA-binding47.44.5e-15143185145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r+ WT  Ed +l+++++  G++ W+ Iar +  gR+++++k++w+
  TRIUR3_28918-P1 143 RKIWTDAEDIKLIELHHTCGNR-WSVIARLLS-GRSENDVKNHWN 185
                      567*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.41586141IPR017930Myb domain
SuperFamilySSF466895.62E-2989184IPR009057Homeodomain-like
SMARTSM007174.1E-1390139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-2194142IPR009057Homeodomain-like
PfamPF139212.5E-1694154No hitNo description
CDDcd001671.91E-1294135No hitNo description
SMARTSM007174.5E-14142190IPR001005SANT/Myb domain
PROSITE profilePS5129414.567143192IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-18143189IPR009057Homeodomain-like
CDDcd001675.70E-12146188No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MAEGSAYFDW DVEAVSSGHG GVAQHFIHND GGALAGVIVP AAGSRPFGGI GEMDPTTFPD  60
YGSSDAPMAI AAPARAPARA RSSSQGLTRF KRFWTVEEDT LLRAKVQEFG EGSWMQVASY  120
LPSRSGKQCR ERWVNQLDPN IERKIWTDAE DIKLIELHHT CGNRWSVIAR LLSGRSENDV  180
KNHWNATKRS LKAKRQLKKR NSEQPPPGQL SLLAEYIRSM EPHIGSPAET PPVSPPLYHD  240
QEHGGKIGMA GRDAAIVIAP TAQAHLTYPN PAMTGMHYHP NPTNMQYWAP DLNVADGPNE  300
GYSYYIPPNA HLHNRMSYGL SPTQMLGEQD IQQTTNVSMN MYAFSGQHSL MASNLKAVAE  360
MHRECSANNQ LGNVGDGAGG WSYYYDIDAT SSSGLAGGSA SCSDHDVIDV VQMASRVFAA  420
QD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-289418710103B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLT1NEB80.0T1NEB8_TRIUA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.13e-34myb domain protein 98